PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.13129s0396.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family WOX
Protein Properties Length: 193aa    MW: 21973.7 Da    PI: 9.4266
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.13129s0396.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox628.8e-202687157
                          TT--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
              Homeobox  1 rrkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                          ++ R+++t eq++ L +lF+   r+ps++++++++++l    +++ ++V++WFqN++a+e++
  Bostr.13129s0396.1.p 26 KCGRWNPTVEQVKLLTDLFKAgLRTPSTDQIQKISTELsfygKIESKNVFYWFQNHKARERQ 87
                          568*****************99**************************************97 PP

2Wus_type_Homeobox111.73.8e-362689265
     Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                          ++ RW+Pt eQ+k+L++l+k+GlrtP++++iq+i++eL+ yGkie+kNVfyWFQN+kaRerqk+
  Bostr.13129s0396.1.p 26 KCGRWNPTVEQVKLLTDLFKAGLRTPSTDQIQKISTELSFYGKIESKNVFYWFQNHKARERQKR 89
                          678***********************************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.5762388IPR001356Homeobox domain
SMARTSM003897.1E-42592IPR001356Homeobox domain
PfamPF000468.7E-172787IPR001356Homeobox domain
SuperFamilySSF466897.7E-112891IPR009057Homeodomain-like
CDDcd000864.77E-42989No hitNo description
Gene3DG3DSA:1.10.10.601.9E-72987IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 193 aa     Download sequence    Send to blast
MSHGGFTIKA RGSGNNINGG GGTGTKCGRW NPTVEQVKLL TDLFKAGLRT PSTDQIQKIS  60
TELSFYGKIE SKNVFYWFQN HKARERQKRR KISNVDFDHR QDTDLSSPHR YNPRLHQPPR  120
KDIFEVCDEE EKVIETLQLF PLSKVERVRA NVTAASHNEY TLEQVKTTTF STYSTCGAEM  180
EHPPLDLRLS FL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM0169090.0KM016909.1 Arabidopsis thaliana WOX7 (WOX7) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010423430.11e-113PREDICTED: WUSCHEL-related homeobox 7-like
SwissprotQ8H1D24e-80WOX5_ARATH; WUSCHEL-related homeobox 5
TrEMBLD7LZ061e-110D7LZ06_ARALL; Putative uncharacterized protein
STRINGfgenesh1_pg.C_scaffold_60004381e-110(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM40142857
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11260.13e-76WUSCHEL related homeobox 5